Nacalai USA - Innovations for Life Sciences

Subtotal: $0.00

View Cart

Recombinant Mouse FGF-basic (bFGF)

Mouse basic fibroblast growth factor (bFGF or Heparin-binding growth factor 2) is a singlechain polypeptide growth factor. bFGF is expressed in almost all tissues and play important roles in a variety of normal and pathological processes, including development, wound healing and neoplastic transformation. bFGF is mitogenic for many cell types, both epithelial and mesenchymal. Several different forms of the protein exist, ranging from 18-24 kDa in size due to the use of alternative start sites within the FGF-2 gene. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor. Recombinant Mouse basic FGF (FGF-2) produced in E. coli is a non-glycosylated single polypeptide chain containing 145 amino acids with a MW of 16,320 Da. It is purified by proprietary chromatographic techniques.

Amino acid sequence

MALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSI
KGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSK
TGPGQKAILFLPMSAKS

Source

Escherichia Coli.

Purification

Sequential chromatography

Purity

Greater than 97% as determined by SDS-PAGE.

Endotoxin

Less than 0.1 ng/µg cytokine as determined by the LAL assay.

Bioactivity

ED50= 0.1-1.0 ng/ml as determined by the dose dependent proliferation of NIH 3T3 cells.

Formulation

Sterile filtered through a 0.2 micron filter and lyophilized from Tris buffer (10 mM Tris pH7.5, 150 mM NaCl).

Storage/Stability

Mouse bFGF is shipped at 4°C with ice bag. Lyophilized mouse bFGF is stable at -20°C for up to 12 months from date of receipt.

Ordering Information

Product Cat.No. Storage Quantity Price(US$)  
Recombinant Mouse FGF-basic (bFGF) NU03001 -20°C 10 µg 76.00 Buy
Recombinant Mouse FGF-basic (bFGF) NU03002 -20°C 100 µg 260.00 Buy