Nacalai USA - Innovations for Life Sciences

Subtotal: $0.00

View Cart

Recombinant Human FGF-acidic (FGF-1)

Recombinant human Fibroblast Growth Factor-1 is also known as acidic FGF (aFGF). FGF-1 is a bioactive protein intended for use in cell culture applications. It is involved in a number of biological processes including embryonic development, differentiation, survival, tissue repair and migration. FGF-1 is a heparin-binding member of the FGF superfamily of molecules. Its heparin-complex is an angiogenic agent in vivo and a potent mitogen for a variety of cell types in vitro. Recent study found that recombinant FGF1 (rFGF1) resulted in potent, insulin-dependent lowering of glucose levels in diabetic mice. Recombinant human FGF-acidic is a 15.8 kDa protein consisting of 140 amino acid residues.

Amino acid sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQY
LAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQK
AILFLPLPVSSD

Source

Escherichia Coli.

Purity

Greater than 98% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU per µg of protein as determined by the LAL assay.

Bioactivity

ED50 ≤ 1.0ng/mg as determined by the dose dependent proliferation of murine BABL/c 3T3 cells.

Formulation

Sterile filtered through a 0.2 micron filter and lyophilized with no additives.

Storage/Stability

This product is shipped at 4°C with cold pack. It is stable for up to 6 months from date of receipt when stored at -20°C. Multiple freeze/thaw cycles should be avoided as it can result in significant loss of activity.

Reconstitution

Centrifuge the vial before opening. Reconstitute in sterile water to a concentration of 0.1 -1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

Ordering Information

Product Cat.No. Storage Quantity Price(US$)  
Recombiannt Human FGF-acidic (FGF-1) NU03004 -20°C 10 µg 76.00 Buy
Recombiannt Human FGF-acidic (FGF-1) NU03005 -20°C 100 µg 360.00 Buy