Nacalai USA - Innovations for Life Sciences

Subtotal: $0.00

View Cart

Recombinant Human EGF

Recombinant human EGF is a bioactive growth factor protein intended for use in cell culture applications. Epidermal Growth Factor (EGF) plays an important role in the regulation of cell growth, proliferation, and differentiation of specific cells in vivo and serves as a potent mitogenic factor for a variety of culture cells of both ectodermal and mesodermal origin. Recombinant human EGF is 6.2 kDa protein consisting of 54 amino acid residues.

Amino acid sequence

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Source

Escherichia Coli.

Purity

Greater than 98%, as determined by SDS-PAGE.

SDS-PAGE analysis of Recombinant human EGF Sample:

Endotoxin

< 1.0 EU/µg of protein as determined by the LAL assay.

Bioactivity

ED50 < 0.1 ng/ml as determined by its ability to the dose dependent proliferation of mouse BALB/c 3T3 cells.

Formulation

Sterile filtered through a 0.2 micron filter and lyophilized from sterile filtered 1X PBS, pH 7.4.

Storage

Store under sterile conditions in the lyophilized form for up to 12 months at -20°C .

Reconstitution

Centrifuge the vial prior to opening. It is recommended to reconstitute EGF in sterile water to yield a stock solution of 0.1-1.0 mg/ml of EGF. Avoid freeze-thaw cycles as it can result in loss of activity. Do not vortex.

Ordering Information

Product Cat.No. Storage Quantity Price(US$)  
Recombinant Human EGF NU03007 -20°C 10 µg 30.00 Buy
Recombinant Human EGF NU03008 -20°C 100 µg 76.00 Buy