Recombinant Human Sonic Hedgehog (SHH)
| Sonic hedgehog homolog (SHH) is one of three proteins in the mammalian signaling pathway family called hedgehog, the others being desert hedgehog (DHH) and Indian hedgehog (IHH). SHH is the best studied ligand of the hedgehog signaling pathway. It plays a key role in regulating vertebrate organogenesis, such as in the growth of digits on limbs and organization of the brain. Sonic hedgehog is the best established example of a morphogen as defined by Lewis Wolpert's French flag model—a molecule that diffuses to form a concentration gradient and has different effects on the cells of the developing embryo depending on its concentration. SHH remains important in the adult. It controls cell division of adult stem cells and has been implicated in development of some cancers. Recombinant Sonic Hedgehog is an approximately 20 kDa protein expressed in E. coli consisting of 175 amino acid residues, including an N-terminal Ile-Ile sequence substituted for the naturally occurring chemically modified Cys residue. |
| Amino acid sequence : | IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIF KDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITT SDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG |
| Source : | Escherichia Coli. |
| Purity : |
Greater than 98%, as determined by SDS-PAGE.
SDS-PAGE analysis of Recombinant human SHH Sample:
 |
| Purification : | Sequential Chromatography |
| Endotoxin : | Less than 0.1 ng/mg (1.0 EU/µg) of SHH as determined by the LAL assay. |
| Bioactivity : | ED50 is less than 0.75 µg/ml as determined by its ability to induce alkaline phosphatase production by C3H10T1/2 fibroblasts. |
| Formulation : | Lyophilized (freeze-dried) from a 0.22 sterile-filtered solution in 1x PBS & 0.1 M NaCl. |
| Storage : | Lyophilized hSHH is stable at -20°C to -80°C for up to 12 months from date of receipt. hSHH is stable for at least 3 months when stored in working aliquot with a carrier protein at -20°C. |
| Reconstitution ; | Centrifuge vial before opening. It is recommended to reconstitute hSHH in sterile water to yield a stock solution of 0.1-0.5 mg/ml of hSHH. It is stable for up to 6 months when stored at -20°C and up to 12 months when stored at -80°C. Avoid Multiple freeze/thaw cycles. |
Downloads
Recombinant Proteins (Brochure)Ordering Information
| Product | Cat.No. | Storage | PKG Size | Price(US$) | |
|---|---|---|---|---|---|
| Recombinant Human Sonic Hedgehog (SHH), Carrier Free (Lyophilized) | NU03018-1 | -20°C | 25 µg | 229.00 | Buy |
| Recombinant Human Sonic Hedgehog (SHH), Carrier Free (Lyophilized) | NU03018-2 | -20°C | 100 µg | 658.00 | Buy |
| Recombinant Human Sonic Hedgehog (SHH), Carrier Free (Lyophilized) | NU03018-3 | -20°C | 1 mg | 3,286.00 | Buy |