Recombinant Human IGF-1
| Recombinant human Insulin-like Growth Factor-1(IGF-1) is a bioactive protein intended for use in cell culture applications. IGF-1 plays an important role in cellular energy metabolism and in growth and development, especially prenatal growth. IGF-1 exerts its actions exclusively through the IGF-1 receptor (IGF-1R). IGF-1 has been involved in proliferation, differentiation, survival, growth, apoptosis and regeneration. Recombinant human IGF-1 is 7.65kDa protein consisting of 70 amino acid residues. |
| Amino acid sequence : | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPL KPAKSA |
|
Source :
|
Escherichia Coli. |
| Purity : |
Greater than 98%, as determined by SDS-PAGE.
SDS-PAGE analysis of Recombinant human IGF-1 Sample:
 |
| Endotoxin : | < 1.0 EU/µg of protein as determined by the LAL assay. |
| Bioactivity : | ED50 ≤ 1.0ng/mg as determined by the dose dependent proliferation of murine BABL/c 3T3 cells. |
| Formulation : | Sterile filtered through a 0.2 micron filter. Lyophilized with no additives. |
| Reconstitution ; | Centrifuge the vial before opening. Reconstitute in sterile water to a concentration of 0.1 -1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |
| Storage/Stability: | This product is shipped at 4°C with cold pack. It is stable for up to 6 months from date of receipt when stored at -20°C. Multiple freeze/thaw cycles should be avoided as it can result in significant loss of activity. |
Recombinant Proteins (Brochure)