Nacalai USA - Innovations for Life Sciences

Subtotal: $0.00

View Cart

Recombinant Human FGF-acidic (FGF-1)

Recombinant human Fibroblast Growth Factor-1 is also known as acidic FGF (aFGF). FGF-1 is a bioactive protein intended for use in cell culture applications. It is involved in a number of biological processes including embryonic development, differentiation, survival, tissue repair and migration. FGF-1 is a heparin-binding member of the FGF superfamily of molecules. Its heparin-complex is an angiogenic agent in vivo and a potent mitogen for a variety of cell types in vitro. Recent study found that recombinant FGF1 (rFGF1) resulted in potent, insulin-dependent lowering of glucose levels in diabetic mice. Recombinant human FGF-acidic is a 15.8 kDa protein consisting of 140 amino acid residues.

 

Amino acid sequence :
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQY
LAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQK
AILFLPLPVSSD
Source : Escherichia Coli.
Purity : Greater than 98% as determined by SDS-PAGE.
Endotoxin : Less than 1.0 EU per µg of protein as determined by the LAL assay.
Bioactivity :  ED50 ≤ 1.0ng/mg as determined by the dose dependent proliferation of murine BABL/c 3T3 cells.
Formulation : Sterile filtered through a 0.2 micron filter and lyophilized with no additives.
Reconstitution ; Centrifuge the vial before opening. Reconstitute in sterile water to a concentration of 0.1 -1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

Ordering Information

Product Cat.No. Storage PKG Size Price(US$)  
Recombinant Human FGF-acidic (FGF-1) NU03004-1 -20°C 10 µg 70.00 Buy
Recombinant Human FGF-acidic (FGF-1) NU03004-2 -20°C 100 µg 280.00 Buy
Recombinant Human FGF-acidic (FGF-1) NU03004-3 -20°C 1 mg 1,200.00 Buy