Recombinant human Fibroblast Growth Factor-1 is also known as acidic FGF (aFGF). FGF-1 is a bioactive protein intended for use in cell culture applications. It is involved in a number of biological processes including embryonic development, differentiation, survival, tissue repair and migration. FGF-1 is a heparin-binding member of the FGF superfamily of molecules. Its heparin-complex is an angiogenic agent in vivo and a potent mitogen for a variety of cell types in vitro. Recent study found that recombinant FGF1 (rFGF1) resulted in potent, insulin-dependent lowering of glucose levels in diabetic mice. Recombinant human FGF-acidic is a 15.8 kDa protein consisting of 140 amino acid residues. |
Amino acid sequence : |
FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQY
LAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQK
AILFLPLPVSSD
|
Source : | Escherichia Coli. |
Purity : | Greater than 98% as determined by SDS-PAGE. |
Endotoxin : | Less than 1.0 EU per µg of protein as determined by the LAL assay. |
Bioactivity : | ED50 ≤ 1.0ng/mg as determined by the dose dependent proliferation of murine BABL/c 3T3 cells. |
Formulation : | Sterile filtered through a 0.2 micron filter and lyophilized with no additives. |
Reconstitution ; | Centrifuge the vial before opening. Reconstitute in sterile water to a concentration of 0.1 -1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C. |