Nacalai USA - Innovations for Life Sciences

Subtotal: $0.00

View Cart

Recombinant Human VEGF-165

Vascular Endothelial Growth Factor (VEGF) is a potent mediator of both angiogenesis and vesculogenesis in the fetus and adult. It stimulates proliferation and survival of endothelial cells and promotes angiogenesis and vascular permeability. VEGF is a secreted homodimeric protein secreted by a variety of vascularized tissues. Human recombinant VEGF165 is a 38.2 kDa disulfide-linked homodimeric protein consisting of two 165amino acid polypeptide chain.

Amino acid sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDE
GLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLF
VQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Source

Escherichia Coli.

Purity

Greater than 98%, as determined by SDS-PAGE.

SDS-PAGE analysis of Recombinant human IGF-1 Sample:

Endotoxin

< 1.0 EU/μg of protein as determined by the LAL assay.

Bioactivity

ED50 ≤ 1.0ng/mg as determined by the dose dependent proliferation of murine BABL/c 3T3 cells.

Formulation

Sterile filtered through a 0.2 micron filter. Lyophilized with no additives.

Storage/Stability

This product is shipped at 4°C. with cold pack. It is stable for up to 6 months from date of receipt when stored at -20°C. Multiple freeze/thaw cycles should be avoided as it can result in significant loss of activity.

Reconstitution

Centrifuge the vial before opening. Reconstitute in sterile water to a concentration of 0.1 -1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

Ordering Information

Product Cat.No. Storage Quantity Price(US$)  
Recombinant Human VEGF-165 NU03013 -20°C 10 µg 180.00 Buy
Recombinant Human VEGF-165 NU03014 -20°C 100 µg 740.00 Buy